PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016512582.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SRS
Protein Properties Length: 347aa    MW: 37209.8 Da    PI: 6.4994
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016512582.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702224.22.6e-691192803155
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa............aeaaskrkrelkskkqsa 85 
                      g++sCqdCGnqakkdC+h+RCRtCCksrgf+C+thvkstWvpaakrrerqqql+++++++++++            +++ +kr+re    ++s+
  XP_016512582.1 119 GGGISCQDCGNQAKKDCEHMRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLTTLQQQQEEQQqqqqqqqtlqlhRDNIPKRQRE--DPSASS 211
                     5789***************************************************99998887774445444444333333333333..355667 PP

          DUF702  86 lsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGleek 155
                     l +t++  + s++ le+ ++P++vss+avf+cvr+ssvdd+e+++aYqtav+igGhvfkGiLydqG+e++
  XP_016512582.1 212 LVCTRILPS-STSGLEVGNFPAKVSSNAVFHCVRMSSVDDAEDQFAYQTAVNIGGHVFKGILYDQGPENQ 280
                     777777665.455899999************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051427.5E-67121278IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.8E-27123165IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.0E-27230277IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MAGFFSLGGG AASSSQAQDQ QQHQQSTNNP PTEISPDSWF LYRNDQELPT YRGFELWQTS  60
NSQPQIRHPI NPLQDLYPTA AVGLGDGPTR SGFTVTATRP DHDPSSGGSG GLVMMRSGGG  120
GISCQDCGNQ AKKDCEHMRC RTCCKSRGFQ CQTHVKSTWV PAAKRRERQQ QLTTLQQQQE  180
EQQQQQQQQQ TLQLHRDNIP KRQREDPSAS SLVCTRILPS STSGLEVGNF PAKVSSNAVF  240
HCVRMSSVDD AEDQFAYQTA VNIGGHVFKG ILYDQGPENQ YMAAGESSSG GGSASHQHNL  300
IGAVGTATSA ATTSASGGGA AAAPEASPYL DPSLYPAPLN TFMADTP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC3319120.0KC331912.1 Solanum lycopersicum expression of terpenoids 3 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016512582.10.0PREDICTED: protein SHI RELATED SEQUENCE 1-like isoform X2
SwissprotQ9SD403e-88SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
SwissprotQ9XGX01e-88SHI_ARATH; Protein SHORT INTERNODES
TrEMBLA0A0V0IDY81e-176A0A0V0IDY8_SOLCH; Uncharacterized protein
STRINGPGSC0003DMT4000093071e-166(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.19e-64Lateral root primordium (LRP) protein-related